PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00004073-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 275aa    MW: 30902.8 Da    PI: 7.4537
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00004073-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18.4e-101291661954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yps +++  LA+++gL+ +qV +WF N R +
  SMil_00004073-RA_Salv 129 FEHflHPYPSDADKHLLARQTGLSRNQVANWFINARVR 166
                            665559******************************98 PP

2BELL92.93e-309631872
                   BELL 18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                           +Vd+rY++y+e +q+v++sF++++g g+a+pYtslA+ka+SrhFrcL++a+aeq+
  SMil_00004073-RA_Salv  9 QVDRRYNHYCERMQMVVNSFDTIIGFGAAAPYTSLAQKAMSRHFRCLREAVAEQL 63
                           8****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.8E-5161IPR006563POX domain
PfamPF075264.2E-25959IPR006563POX domain
PROSITE profilePS5007112.39107170IPR001356Homeobox domain
SMARTSM003894.1E-9110174IPR001356Homeobox domain
CDDcd000861.79E-12110171No hitNo description
SuperFamilySSF466891.2E-17111178IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-28113176IPR009057Homeodomain-like
PfamPF059202.9E-18127166IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MIAIDVNFQV DRRYNHYCER MQMVVNSFDT IIGFGAAAPY TSLAQKAMSR HFRCLREAVA  60
EQLRQSCEQL GEKDTMKSGL TKGETPRLKF LEQSLRQHHA AFHHMDQEAW RPQRGLPQRS  120
VTILRAWLFE HFLHPYPSDA DKHLLARQTG LSRNQVANWF INARVRLWKP MVEEMYLQEA  180
KDHSNPTTTT AAAAADTSPP PALAKINVLE SDPSSVSFNT SENHTDTNHA SPPTAAPPHC  240
FPPGVDPAII RFGTSSGDVS LTLGLRHSGD EFFPT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16116174563Homeobox protein Meis2
3k2a_B4e-16116174563Homeobox protein Meis2
4xrm_A4e-16116174563Homeobox protein Meis2
4xrm_B4e-16116174563Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1825704e-39AC182570.2 Erythranthe guttata clone MGBa-64L10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099269.11e-115PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-103BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLA0A022RUY31e-114A0A022RUY3_ERYGU; Uncharacterized protein
STRINGSolyc02g089940.2.11e-110(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.23e-99BEL1-like homeodomain 2